SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018725 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018725
Domain Number 1 Region: 133-284
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.84e-28
Family Dual specificity phosphatase-like 0.00094
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000018725
Domain Number - Region: 6-59
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000237
Family Cell cycle control phosphatase, catalytic domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018725   Gene: ENSGGOG00000014256   Transcript: ENSGGOT00000022450
Sequence length 295
Comment pep:known_by_projection chromosome:gorGor3.1:7:73055733:73087488:-1 gene:ENSGGOG00000014256 transcript:ENSGGOT00000022450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YFSFPDVRSKWEYDESHVITALQVKKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILL
KDDDDDSDSDGDGKDTKRESDIKPLCPSPSSKHCQLMPNLTEEEVSRKRTGWSCLRGTQN
FFKKGDFIWHQQAELDAFQPYPIEIVPGKVFIGNFSQACDPKIQKDLKIKAHVNVSMDTG
PFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHLHLGSVILIFSTQGISRSCAAII
AYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY
Download sequence
Identical sequences ENSGGOP00000013905 ENSGGOP00000018725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]