SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018764 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018764
Domain Number 1 Region: 42-255
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.04e-80
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000183
Further Details:      
 
Domain Number 2 Region: 544-762
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-59
Family Ankyrin repeat 0.0000188
Further Details:      
 
Domain Number 3 Region: 251-382
Classification Level Classification E-value
Superfamily E set domains 1.33e-25
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000168
Further Details:      
 
Domain Number 4 Region: 810-891
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-16
Family DEATH domain, DD 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000018764
Domain Number - Region: 876-924
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0103
Family DNA polymerase beta, N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018764   Gene: ENSGGOG00000009071   Transcript: ENSGGOT00000033520
Sequence length 970
Comment pep:known_by_projection chromosome:gorGor3.1:4:111773799:111869672:1 gene:ENSGGOG00000009071 transcript:ENSGGOT00000033520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRY
VCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCE
DGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQ
AEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAI
YDSRTEAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGF
GDFSPTDVHRQVSNFIKTYRYRILSLELSPGQVVSMLRKKSLNTLHPPHFYYPGIPYKEE
VQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGIT
FHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGN
GEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV
QDENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVV
EDLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLA
MMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYD
GTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDM
ATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQK
LGLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTT
SQAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDY
GQEGPLEGKI
Download sequence
Identical sequences ENSGGOP00000018764 ENSGGOP00000008878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]