SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018843 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018843
Domain Number 1 Region: 137-403
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.44e-57
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 91-152
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000382
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 32-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000043
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018843   Gene: ENSGGOG00000013039   Transcript: ENSGGOT00000024390
Sequence length 404
Comment pep:known_by_projection chromosome:gorGor3.1:16:62323617:62355134:1 gene:ENSGGOG00000013039 transcript:ENSGGOT00000024390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTE
GDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPETANGYGEHSIRYQCKNYYRLRTEG
DGVYTLNDKKQWINKAVGDKLPECEAVCGKPNPANPVQRILGGHLDAKGSFPWQAKMVSR
HNLTTGASLINEQWLLTTAKNLFLSHSENAIAKDIAPTLTLYVGEKQLVEIEKVVLHPNY
HQVDIGLIKLKQKVPVNERVMPICLPSKDYAEAGRVGYASGWGQSDNFKLTDHLKYVMLP
VADQDQCIRHYEGGTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVH
DLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN
Download sequence
Identical sequences ENSGGOP00000024143 ENSGGOP00000018843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]