SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018871 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018871
Domain Number 1 Region: 2-175
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-51
Family Phosphotyrosine-binding domain (PTB) 0.0000000708
Further Details:      
 
Domain Number 2 Region: 325-411
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000166
Family SH2 domain 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018871   Gene: ENSGGOG00000027970   Transcript: ENSGGOT00000024560
Sequence length 414
Comment pep:novel chromosome:gorGor3.1:X:61673287:61674609:1 gene:ENSGGOG00000027970 transcript:ENSGGOT00000024560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPMWGWLHPNDKVMRPGVSYLVWYMGCVEVLQSMSALDFNTWTQVTREAISLVCEAVPGA
KGVTRRRKPCNHPLSSILGRSNLKFAAMTIILTISTSSLNVMVADCKQIITNNHMQSISF
ASSGDPDTAKYVANVAKDPVSQKACHILECPEGLAQDVISTIGQAFKLHFKQYLRKPPKL
VTPHDRMTGFDGLAWDEEEEEPPGHQHYNDFLGRNPLFGQGATPGAARPTPPSAQTPSHL
GSTLPVGQSVGGDPEMPPPPPCPGRELFDDPSNVNVQNLDKARQAGGGAGTPNPAINGST
PWDLFDMKPFEDALHMPPPPQLVSMAKQEAEALLQLNGDFLVQESMTTPGQYVLTGLQSG
ESKHLLLVDPEGVVRTKDHRFESVSHLISYHMDSLAITSAGSELCLQQPVEQKL
Download sequence
Identical sequences ENSGGOP00000018871 ENSGGOP00000018871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]