SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018908 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018908
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily EF-hand 9.07e-18
Family S100 proteins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018908   Gene: ENSGGOG00000023574   Transcript: ENSGGOT00000023645
Sequence length 435
Comment pep:known_by_projection chromosome:gorGor3.1:1:131375229:131377686:-1 gene:ENSGGOG00000023574 transcript:ENSGGOT00000023645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRL
LDEDHTGTVEFKEFLVLVFKVAQACFKTLSESPEGACGSHESGSLHSRASQELGEGQRSG
TEVGRAGKGQHYEGSSHRQSQQGSRGQNRPGVQTQGQATGSAWVSSYDRQAESQNQERIS
PQIQLSGQTEQTQKAGEGKRNQTTEMRPERQPQTREQDRAHQTGEIVTGSGTQTQAGATQ
TVEQDSSHQTGSTSTQTQESINSQNRGTEIHGQGRSQTSQAVTGGHTQTQAGSHTQTVEQ
DRSQTVSHGGAREQGQTQTQPGSGQRWMQVSNPEAGETVPGGQAQTRASTESGRQEWSST
HPRRCVTEGQGDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG
ITARELYSYLRSNKP
Download sequence
Identical sequences ENSGGOP00000018908 ENSGGOP00000018908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]