SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019250 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019250
Domain Number 1 Region: 149-267
Classification Level Classification E-value
Superfamily EF-hand 1.06e-35
Family Osteonectin 0.0087
Further Details:      
 
Domain Number 2 Region: 237-330
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.36e-26
Family Thyroglobulin type-1 domain 0.00065
Further Details:      
 
Domain Number 3 Region: 86-131
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000013
Family Ovomucoid domain III-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019250   Gene: ENSGGOG00000023784   Transcript: ENSGGOT00000030031
Sequence length 375
Comment pep:known_by_projection chromosome:gorGor3.1:10:84638277:84663896:-1 gene:ENSGGOG00000023784 transcript:ENSGGOT00000030031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPGCGRLVLPLLEVEDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRA
MCISRKKLEHRIKQPTVKLHGNKDSICKPCHMAQLASVCGSDGHTYSSVCKLEQQACLSS
KQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSAS
SVASPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEVCIRPFFNSC
DTYKDGRVSTAEWCFCFWREKPPCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCD
QSSGDCWCVDQLGLELTGTRTHGSPDCDDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEE
EEGEAGEADDGGYIW
Download sequence
Identical sequences ENSGGOP00000019250 ENSGGOP00000019250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]