SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019395 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019395
Domain Number 1 Region: 1452-1758
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.7e-75
Family Rap/Ran-GAP 0.00034
Further Details:      
 
Domain Number 2 Region: 80-599
Classification Level Classification E-value
Superfamily ARM repeat 4.87e-22
Family Armadillo repeat 0.085
Further Details:      
 
Domain Number 3 Region: 448-647,692-919
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000875
Family HEAT repeat 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019395   Gene: ENSGGOG00000027370   Transcript: ENSGGOT00000031633
Sequence length 1808
Comment pep:known_by_projection chromosome:gorGor3.1:16:2169086:2223377:1 gene:ENSGGOG00000027370 transcript:ENSGGOT00000031633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKPTSKDSGLKEKFKILLGLGTPRPNPRSAEGKQTEFIITAEILRVRQAAEVGQGHGVE
GLMLVCSLEESHKQGFWHAVEALWKAVADLLQPERPLEARHAVLALLKAIVQGQGERLGV
LRALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELADFVLQWMDVGLSSEFLL
VLVNLVKFNSCYLDEYIARMVQMICLLCVRTASSVDIEVSLQVLDAVVCYNCLPAESLPL
FIVTLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCHLMEDRAYMEDAPLLRGAVFF
VGMALWGAHRLYSLKNSPTSVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVAW
DILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQERYFELVERCADQR
PESSLLNLISYRAQSIHPAKDGWIQNLQALMERFFRSESRGAVRIKVLDVLSFVLLINRQ
FYEEELINSVVISQLSHIPEDKDHQVRKLATQLLVDLAEGCHTHHFNSLLDIIEKVMARS
LSPPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHY
KHSYTLPIASSIRLQAFDFLLLLRADSLHRLGLPNKDGVVRFSPYCVCDYMEPERGSEKK
SGPLSPPTGPPGPAPAGPAVRLGSVPYSLLFRVLLQCLKQESDWKVLKLVLGRLPESLRY
KVLIFTSPCSVDQLCSALCSMLSGPKTLERLRGAPEGFSRTDLHLAVVPVLTALISYHNY
LDKTKQREMVYCLEQGLIHRCASQCVVALSICSVEMPDIIIKALPVLVVKLTHISATASM
AVPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIR
CRLPFRKDFVPFITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNN
SPPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSVAQADDSLKNLH
LELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRS
LLGLDSGELQSGPESSSSPGVHVRQTKEAPAKLESQAGQQVSRGARDRVRSMSGGHGLRV
GALDVPASQFLGSATSPGPRTTPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILV
RRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSVPAAS
TAKPPPLPRSNTVASFSSLYQSSCQGQLHRSVSWADSAVVMEEGSPGEVPVPVEPPGLED
VEAALGMDRCTDAYSRSSSVSSQEEKSLHAEELVGRGIPIERAVSSEGGRPSVDLSFQPS
QPLSKSSSSPELQTLQDILGDPGDKADVGRLSPEVKARSQSGTLDGESAAWSASGEDSRG
RPEGPLPSSSPRSPSGLRPRGYTISDSAPSRRGKRVERDALKSRATASNAEKVPGINPSF
VFLQLYHSPFFGDESNKPILLPNESQSFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSEL
AILSNEHGSYRYTEFLTGLGRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVF
HIATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIVTPLDYE
CNLVSLQCRKDMEGLVDTSVAKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSK
WIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSYTKAPAQTPAEPTPGYEVGQRKRLISS
VEDFTEFV
Download sequence
Identical sequences ENSGGOP00000019395 ENSGGOP00000019395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]