SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019834 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019834
Domain Number 1 Region: 398-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.32e-26
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 454-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-24
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 3 Region: 204-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 342-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-19
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 6 Region: 260-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-19
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 7 Region: 150-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000294
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 8 Region: 305-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000306
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019834   Gene: ENSGGOG00000008988   Transcript: ENSGGOT00000028260
Sequence length 510
Comment pep:known_by_projection chromosome:gorGor3.1:19:41428584:41436587:1 gene:ENSGGOG00000008988 transcript:ENSGGOT00000028260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVTFKDVAVVFSREELRLLDLTQRKLYRDVMVENFKNLVAVGHLPFQPDMVSQLEAEEK
LWMMETETQRSRYSGSKHQNKMETLQKFALKYLSNQELSCWQIWKQVASELTRCLQGKSS
ITSDSIQVSENGDSSIYIEAGILKTDTEPKPCKGNEYGKIISDGSNQKLPLGEKPHPCGE
CGRGFSYSPRLPLHQNVHTGEKCFSQSSHLQTHQRIHPGEKPYRCDSCGKGFSSSTGLII
HYRTHTGEKPYKCEECGKCFSQSSNFQCHQRVHTEEKPYKCEECGKGFGWRGIKGHQRVH
TGEKPYKCDVCGKGFSHNSPNMHRRVHTGEKPYKCEACGKGFTRNTDLHIHFRVHTGEKP
YKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHTGEKPYRCD
VCGKDFSYSSNLKLHQVIHTGEKPYKCEECGKGFSWRSNLHAHQRVHSGEKPYKCEQCDK
SFSQAIDFRVHQRVHTGEKPYKCGVCGKGF
Download sequence
Identical sequences ENSGGOP00000019834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]