SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019934 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019934
Domain Number 1 Region: 11-92
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.81e-23
Family beta-glycanases 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019934   Gene: ENSGGOG00000026622   Transcript: ENSGGOT00000023801
Sequence length 98
Comment pep:novel chromosome:gorGor3.1:5:83177478:83178018:-1 gene:ENSGGOG00000026622 transcript:ENSGGOT00000023801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFYTPPVWLRTVPVTESQFLISGKPFYFHGINKHEDADIQGKGFDCPLLVKDFNLLCWLG
ANTFCTSHYPYTEEMLQICYRYGIVVIDECPAVGLMLP
Download sequence
Identical sequences ENSGGOP00000019934 ENSGGOP00000027960 ENSGGOP00000019934 ENSGGOP00000027960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]