SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019942 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000019942
Domain Number - Region: 243-316
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.0963
Family GS domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019942   Gene: ENSGGOG00000027588   Transcript: ENSGGOT00000024666
Sequence length 318
Comment pep:known_by_projection chromosome:gorGor3.1:11:109864224:109872543:-1 gene:ENSGGOG00000027588 transcript:ENSGGOT00000024666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVMETCSKGLLTQVTQFWNLLDDLAESDPEGYEKFIQQQLKEGKQLCAAPEPQLCLQTR
ILKPKEKILFINLCQWTRIPAPQSTTHPVPLTVGKPEDTTGITDAYTVIDVAYNPDVLQA
AEKDQVKKNQLIQMAMKCIEEKFQFTLSHSYHITKFRIKGSIQRMKQNLMGIQTDSIDLR
EKMRRELTLGQIRSSTMSNPDHFPQLLLPKDQVSGKAVCLIEEISSTEIQVEMKMPAYEL
KIVHDHSEKPLKIELKVELPGINSVSLCDLSVSEDDLLIEVSEKYRLHLNLPKLIDTEMT
TAKFIKEKSTLIITMPLV
Download sequence
Identical sequences ENSGGOP00000019942 ENSGGOP00000019942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]