SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020267 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020267
Domain Number 1 Region: 422-586
Classification Level Classification E-value
Superfamily PH domain-like 4.24e-58
Family Phosphotyrosine-binding domain (PTB) 0.0000000466
Further Details:      
 
Domain Number 2 Region: 600-723
Classification Level Classification E-value
Superfamily PDZ domain-like 1.3e-21
Family PDZ domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 715-799
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-16
Family PDZ domain 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020267   Gene: ENSGGOG00000016410   Transcript: ENSGGOT00000025963
Sequence length 806
Comment pep:known_by_projection chromosome:gorGor3.1:9:50952177:51036030:-1 gene:ENSGGOG00000016410 transcript:ENSGGOT00000025963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHLEGSAEVEVTDEAAGGEVNESVEADLEHPEVEEEQQQPPQQQHYVGRHQRGRALEDL
RAQLGQEEEERGECLARSASTESGFHNHTDTAEGDVIAAARDGYDAERAQDPEDESAYAV
QYRPEAEEYTEQAEAEHAEATHRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGED
EPYAEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDEAAAYRQEALGARLHHYDE
RSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDL
ERPPQRYSKEKRDAISLAIKDIKEAIEEVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDC
DDQRPMDGDSPSPGSSSPLGAESSSTSLHPSDPAEASTNKESRKSLASFPTYVEVPGPCD
PEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLAKSRKKAPEGES
QPMTEVDLFISTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRMPRSNSQEN
VEASHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEY
SDLLNTQDMYNDDLIHFSKSENCKDVFIEKQKGEILGVVIVESGWGSILPTVIIANMMHG
GPAEKSGKLNIGDQIMSINGTSLVGLPLSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIR
RPDLRYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATPHEKIVHILSNA
VGEIHMKTMPAAMYRLLTAQEQPVYI
Download sequence
Identical sequences ENSGGOP00000020267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]