SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020307 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020307
Domain Number 1 Region: 318-612
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.26e-52
Family Glycerophosphoryl diester phosphodiesterase 0.0015
Further Details:      
 
Domain Number 2 Region: 6-113
Classification Level Classification E-value
Superfamily Starch-binding domain-like 3.93e-21
Family Starch-binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020307   Gene: ENSGGOG00000011512   Transcript: ENSGGOT00000026786
Sequence length 672
Comment pep:known_by_projection chromosome:gorGor3.1:20:5663794:5733413:-1 gene:ENSGGOG00000011512 transcript:ENSGGOT00000026786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPSQVAFEIRGTLLPGEVFAICGSCDALGNWNPQNAVALLPENDTGESMLWKATIVLSR
GVSVQYRYFKGYFLEPKTIGGPCQVIVHKWETHLQPRSITPLESEIIIDDGQFGIHNGVE
TLDSGWLTCQTEIRLRLHYSEKPPVSITKKKLKKSRFRVKLTLEGLEEDDDDRVSPTVLH
KMSNSLEISLISDNEFKCRHSQPECGYGLQPDRWTEYSIQTMEPDNLELIFDFFEEDLSE
HVVQGDALPGHVGTACLLSSTIAESGKSAGILTLPIMSRNSRKTIGKVRVDYIIIKPLPG
YSCDMKSSFSKYWKPRIPLDVGHRGAGNSTTTAQLAKVQENTIASLRNAASHGAAFVEFD
VHLSKDFVPVVYHDLTCCLTMKKKFDADPVELFEIPVKELTFDQLQLLKLTHVTALKSKD
RKESVVQEENSFSENQPFPSLKMVLESLPEDVGFNIEIKWICQQRDGMWDGNLSTYFDMN
LFLDIILKTVLENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSEIYPELMDLRS
RTTPIAMSFAQFENLLGINVHTEDLLRNPSYIQEAKAKGLVIFCWGDDTNDPENRRKLKE
LGVNGLIYDRIYDWMPEQPNIFQVEQLERLKQELPELKSCLCPTVSRFVPSSLCGESDIH
VDANGIDNVENA
Download sequence
Identical sequences G3R799 Q9NPB8
gi|25901062|ref|NP_062539.1| ENSP00000368305 NP_062539.1.87134 NP_062539.1.92137 XP_004061827.1.27298 XP_005260815.1.92137 XP_006723659.1.92137 XP_018872889.1.27298 XP_018872890.1.27298 9606.ENSP00000368305 399983 ENSGGOP00000011230 ENSGGOP00000020307 ENSGGOP00000011230 ENSP00000368305 ENSP00000368305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]