SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020380 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020380
Domain Number 1 Region: 56-178,211-259
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.83e-21
Family Nucleotide and nucleoside kinases 0.0015
Further Details:      
 
Domain Number 2 Region: 268-475
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-19
Family Nucleotide and nucleoside kinases 0.005
Further Details:      
 
Domain Number 3 Region: 177-205
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0000000759
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020380
Domain Number - Region: 13-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020380   Gene: ENSGGOG00000002135   Transcript: ENSGGOT00000026405
Sequence length 483
Comment pep:known_by_projection chromosome:gorGor3.1:9:116325984:116480500:-1 gene:ENSGGOG00000002135 transcript:ENSGGOT00000026405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGATPAPHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHRDNDNVPRI
VILGPPASGKTTIAMWLCKHLNSSLLTLENLILNEFSYTATEARRLYLQRKTVPSALLVQ
LIQERLAEEDCIKQGWILDGIPETREQALRIQTLGITPRHVIVLSAPDTVLIERNLGKRI
DPQTGEIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPKILKVI
SADQPCVDVFYQALTYVQSNHRTNAPFTPRVLLLGPVGSGKSLQAALLAQKYRLVNVCCG
QLLKEAVADRTTFGELIQPFFEKEMAAPHPLLFGVCCQYLEERKTEEVGWWLSHGLEPNP
RILDHSQFYQLGSYIPYRVFFLNVPFDSIMERLTLRRVDPVTGERYHLMYKPPPTMEIQA
RLLQNPKDAEEQVKLKMDLFYRNLADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPK
KIP
Download sequence
Identical sequences ENSGGOP00000020380 ENSGGOP00000002103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]