SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020475 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020475
Domain Number 1 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 3.77e-19
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020475
Domain Number - Region: 81-101
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0316
Family B-box zinc-binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020475   Gene: ENSGGOG00000015742   Transcript: ENSGGOT00000029655
Sequence length 102
Comment pep:novel chromosome:gorGor3.1:7:72467269:72478495:1 gene:ENSGGOG00000015742 transcript:ENSGGOT00000029655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWQVSLLELEDRLQCPICLEVFKEPLMLQCGHSYCKGCLGSLSYHLDTKLRCPMCWQVV
DGSSSPPNVSLAWVIEALRLPGDLEPKVCVHHRNPLSLFCEK
Download sequence
Identical sequences Q3T483
ENSGGOP00000020475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]