SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020481 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020481
Domain Number 1 Region: 55-184
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-32
Family Nuclear receptor ligand-binding domain 0.00000163
Further Details:      
 
Domain Number 2 Region: 2-45
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000927
Family Nuclear receptor 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020481
Domain Number - Region: 289-338
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000156
Family Nuclear receptor ligand-binding domain 0.0000989
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020481   Gene: ENSGGOG00000028473   Transcript: ENSGGOT00000033229
Sequence length 340
Comment pep:novel chromosome:gorGor3.1:X:64855989:64891404:1 gene:ENSGGOG00000028473 transcript:ENSGGOT00000033229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASST
TSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELG
ERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDL
VFNDLSQNHMERFLPFTYKRGRKTLALRAGVSWVLLLPPKATPLTQKSLKEATVLELSGC
LQTSSLPKVLMGSLRPKEREITCCEDNEHELQSSFLLLFSLLHSQLQPEIARELHQFTFD
LLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Download sequence
Identical sequences ENSGGOP00000020481 ENSGGOP00000020481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]