SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020538 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020538
Domain Number 1 Region: 199-449
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.72e-98
Family STAT DNA-binding domain 0.000000000602
Further Details:      
 
Domain Number 2 Region: 13-198
Classification Level Classification E-value
Superfamily STAT 3.53e-64
Family STAT 0.00000000791
Further Details:      
 
Domain Number 3 Region: 450-588
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-44
Family SH2 domain 0.000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020538   Gene: ENSGGOG00000017110   Transcript: ENSGGOT00000023422
Sequence length 644
Comment pep:known_by_projection chromosome:gorGor3.1:5:41706315:41729833:1 gene:ENSGGOG00000017110 transcript:ENSGGOT00000023422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQG
DMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADW
KRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRP
MLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLK
IKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGR
ANCDIYLEKQESWSLIPETSLFHVKIQLQTHSLPVVVISNICQMPNAWASILWYNMLTNN
PKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITW
AKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTF
LLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNIL
VSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPDCAAPYLKTKFICVTPTTCSNTIDLPM
SPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
Download sequence
Identical sequences ENSGGOP00000016697 ENSGGOP00000020538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]