SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020579 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020579
Domain Number 1 Region: 295-366
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.44e-22
Family Intermediate filament protein, coiled coil region 0.0013
Further Details:      
 
Domain Number 2 Region: 55-87
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000199
Family Intermediate filament protein, coiled coil region 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020579
Domain Number - Region: 168-283
Classification Level Classification E-value
Superfamily Prefoldin 0.0149
Family Prefoldin 0.01
Further Details:      
 
Domain Number - Region: 110-198
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0188
Family Myosin rod fragments 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020579   Gene: ENSGGOG00000016851   Transcript: ENSGGOT00000027664
Sequence length 405
Comment pep:known_by_projection chromosome:gorGor3.1:5:42702512:42739706:1 gene:ENSGGOG00000016851 transcript:ENSGGOT00000027664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMPYNFCLPSLSCRTSCSSRPCVPPSCHSCTLPGACNIPANVSNCNWFCEGSFNGSEKET
MQFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLLCPSYQSYFKTIEELQQKILC
TKSENARLVVQIDNAKLAADDFRTKYQTEQSLRQLVESDINSLRRILDELTLCRSDLEAQ
MESLKEELLSLKQNHEQEVNTLRCQLGDRLNVEVDAAPAVDLNQVLNETRSQYEALVETN
RREVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRDSLENT
LTESEARYSSQLSQVQSLITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSL
LESEDCKLPSNPCATTNACEKPIGSCVTNLCGPRSRCGPCNTFGY
Download sequence
Identical sequences ENSGGOP00000020579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]