SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020988 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020988
Domain Number 1 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 25-85
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 263-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.65e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.61e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 472-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-18
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 7 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 168-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000269
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020988   Gene: ENSGGOG00000014431   Transcript: ENSGGOT00000034597
Sequence length 535
Comment pep:novel chromosome:gorGor3.1:19:21746218:21760593:1 gene:ENSGGOG00000014431 transcript:ENSGGOT00000034597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EITLCFYLLCLHEHLLIVCCQKLANQGPLTFRDVVIEFSQEEWQFLDTAQQDLYRKVMLE
NFRNLVFLGIDVSKPDLITCLEQGKDPWNMKRHGMVATPPVTYSHFAQDLWPQPGIKDSF
QKVILREYGNYGHKDLQLRKGCKSVNECNVQKEGYNELNEYLTTTQSKIFQCDKYVKVFH
KFLNSNTHKTRHTGKKPFKCKKCGKSFCMLLHLGQHKIIHIRENSYQCEECGKAFKWFST
LTRHKRIHTGDKSYKHEECGKGFNQSTTLTRHKVIHAGEKHYKCEECGKAFNWYSHLTRH
KIIHTGEKPYKCEECGKAFNVFATLTRHKIIHTEGKPYKCEECGKAFKQSSNLTTHMKIH
SGEKPYKCGECGKAFFRFSYLTTHKVIHTGEKPYKCEECGKAFNCYSYLTAHKMIHTGEK
PYKCEECGKAFYRFIYLTTHKRIHTGEKPYKCEECGKAFYRLSYLTTHKMIHTVEKRYKC
EECGKAFNWYSRLTTHKRIHTGEKPYKCEECGKGFSVFSTLTKQDNSYWRETLQV
Download sequence
Identical sequences ENSGGOP00000020988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]