SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021264 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000021264
Domain Number - Region: 111-152
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0152
Family FCH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021264   Gene: ENSGGOG00000026065   Transcript: ENSGGOT00000023621
Sequence length 196
Comment pep:known_by_projection chromosome:gorGor3.1:12:12407033:12518245:1 gene:ENSGGOG00000026065 transcript:ENSGGOT00000023621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEG
ERLEPFSMKPDRELRL
Download sequence
Identical sequences G3RZM1 H2NGM6 Q969J3
NP_477517.1.87134 NP_477517.1.92137 XP_003826597.1.60992 XP_004052794.1.27298 ENSPPYP00000004917 ENSP00000321546 GO.35257 HR2423 ENSP00000321546 ENSGGOP00000021264 gi|17157999|ref|NP_477517.1| ENSGGOP00000021264 ENSP00000321546 9600.ENSPPYP00000004917 9606.ENSP00000321546 ENSPPYP00000004917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]