SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021305 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021305
Domain Number 1 Region: 349-441
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-19
Family Pleckstrin-homology domain (PH domain) 0.0072
Further Details:      
 
Domain Number 2 Region: 539-627
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-18
Family Third domain of FERM 0.004
Further Details:      
 
Domain Number 3 Region: 239-290
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000379
Family Second domain of FERM 0.0078
Further Details:      
 
Domain Number 4 Region: 452-538
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000209
Family Second domain of FERM 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021305
Domain Number - Region: 16-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0253
Family Ubiquitin-related 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021305   Gene: ENSGGOG00000012149   Transcript: ENSGGOT00000028770
Sequence length 652
Comment pep:known_by_projection chromosome:gorGor3.1:11:61016308:61031931:1 gene:ENSGGOG00000012149 transcript:ENSGGOT00000028770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMKTASGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEQINRKQDWS
DHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPL
FQAVAAICRLLSIRHPEELSLLRAPPEEELYDLSKVVLAGGVAPALFRGMPAHFSDSAQT
EACYHMLSRPQPPPDPLLLQRLPRPSSLSDKTQLHSRWLDSSRCLMQQGIKAGDALWLRF
KYYSFFDLDPKTDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYHINKLSQSGEVG
EPAGTDPGLDDLDVALSNLEVKLEGSAPTDVLDSLTTIPELKDHLRIFRPRKLTLKGYRQ
HWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEI
YLRCQDEQQYAHWMAGCRLASKGRTMADSSYSSEVQAILAFLSLQRTGSGGQGNHPHGPD
ASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLAEAQLRFIQAWQSLPDFGI
SYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDE
HINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF
Download sequence
Identical sequences ENSGGOP00000021305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]