SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021328 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021328
Domain Number 1 Region: 70-131
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 299-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 722-778
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 355-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 609-666
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-20
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 6 Region: 763-815
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.72e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 666-722
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 8 Region: 572-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000112
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 263-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000159
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021328   Gene: ENSGGOG00000022711   Transcript: ENSGGOT00000024036
Sequence length 886
Comment pep:known_by_projection chromosome:gorGor3.1:7:6630845:6643034:1 gene:ENSGGOG00000022711 transcript:ENSGGOT00000024036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDGSECDPDVKEVLAEEQCPALGTQERLSRGGDAKSPVLQEKGLQASRAPATPRDEDLKG
SFSLSPEALFPQGLVTFEDVAVYFSLEEWERLEADQRGLYQEVMQENYGILVSLGYPIPK
PDLIFRLEQGEEPWVPDSPRPEEGDIVTGVYTGAWFWTDDIEDHEEEDDEDFLAEVAEEE
NEPPGLWSAAYGVGDVPGTWGPDDSDSAQTPEGWGPDPGGLGVLADGSEAKPFLPGREPG
ANLLSPWAFPAVVAPPAGRPETTCDVCGKVFPHRSRLAKHQRYHAAVKPFGCEECGKGFV
YRSHLAIHQRTHTGEKPFPCPDCGKRFVYKSHLVTHRRIHTGERPYRCAFCGAGFGRRSY
LVTHQRTHTGERPYPCPHCGRSFSQSSALARHQAVHTADRPHCCPDCGQAFRLRADFQRH
RRGGGCAEAGGAEDTDPGPEGPEVGEVDGEAEAAAEEREGEEAAVAAPTPSGKVDPAPER
RFLELGNGLGEGEGPSSHPLGFHFPVHPKSWLHPDSFPILGLPDFRERLPALVEGTGLAC
DPCGGGLRAFGPAIGGLLAEPAPAALAEEESPWICSDCGKTFGRRAALAKHQRYHAGERP
HRCADCGKSFVYGSHLARHRRTHTGERPFPCPECGARFARGSHLAAHVRGHTGEKPFVCG
VCGAGFSRRAHLTAHGRAHTGERPYACGECGRRFGQSAALTRHQWAHAEEKPHRCPDCGK
GFGHSSDFKRHRRTHTGEKPFRCADCGRGFAQRSNLAKHRRGHTGERPFPCPECGKRFSQ
RSVLVTHQRTHTGERPYACANCGRRFSQSSHLLTHMKTHRGATAAPGSGSAPAPAPKPEA
AAKGPSSAGPGERGSALLEFAGGTSFGSEHQAAFAGPSGAYREGVL
Download sequence
Identical sequences ENSGGOP00000021328 ENSGGOP00000021328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]