SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021464 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021464
Domain Number 1 Region: 4-44
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000419
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021464   Gene: ENSGGOG00000022875   Transcript: ENSGGOT00000027602
Sequence length 49
Comment pep:novel chromosome:gorGor3.1:X:32736455:32736601:-1 gene:ENSGGOG00000022875 transcript:ENSGGOT00000027602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFDRSVEKWRRFHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLK
Download sequence
Identical sequences Q9UME2
ENSGGOP00000021464 ENSGGOP00000021464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]