SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021584 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021584
Domain Number 1 Region: 291-383
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.78e-25
Family Tudor domain 0.00000298
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 3 Region: 82-162
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021584   Gene: ENSGGOG00000025419   Transcript: ENSGGOT00000032238
Sequence length 520
Comment pep:known_by_projection chromosome:gorGor3.1:1:130726042:130734194:-1 gene:ENSGGOG00000025419 transcript:ENSGGOT00000032238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EERLTFVGEDDIEVEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDVDTEDVGDERVLLI
SGFPVQVCKAKAAIHQILTENTLVSEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCD
KESEGTLLLSRLIKISGTQKEVAAAKHLILEKVSEDEELRKRIAHSAETRVPRKQPISVR
REDVTEPGGAGEPALWKNTSSSMEPTAPLVTPPPKGGGDMAVVVSKEGSWEKPSDDSFQK
SGAQAIPEMSMFEIPSPDFSFHADEYLEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMT
QHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKD
LRALRSDFLSLPFQAIECSLARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQT
GISTWPKIYLYDTSNGKKLDIGLELVHKGYAIELPEDIEENRAVPDMLKDMATETDASLS
TLLTETKKSSGEITHTLSCLSLSEAASMSGDDNLEDDYLL
Download sequence
Identical sequences ENSGGOP00000021584 ENSGGOP00000021584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]