SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021607 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021607
Domain Number 1 Region: 41-268,398-423
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 9.59e-19
Family Integrin alpha N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021607   Gene: ENSGGOG00000003004   Transcript: ENSGGOT00000022999
Sequence length 615
Comment pep:known_by_projection chromosome:gorGor3.1:16:36784156:37061518:-1 gene:ENSGGOG00000003004 transcript:ENSGGOT00000022999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGRLPSSWALFSPLLAGLALLGVGPVPARALHNVTAELFGSEAWGTLAAFGDLNSDK
QTDLFVLRERNDLIVFLADQNAPYFKPKVKVSFKNHSALITSVVPGDYDGDSQMDVLLTY
LPKNYAKSELGAVIFWGQNQTLADPNNMTILNRTFQDEPLIMDFNGDLIPDVFGITNESN
QPQILLGGNLSWHPALTTTSKMRIPHSHAFIDLTEDFTADLFLTTLNATTSTFQFEIWEN
LDGNFSVSTILEKPQNMMVVGQSSFADFARTLHLPFHLLPLNQTSKCQTLQIYIARKDQK
MWLTLKVKICTKNHLEQFVPMVESMRARQVSLPPAKHIGRFRITGFPKVYTLLKNCSAHS
NQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIVVLSK
GYTKNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDAN
GYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGEKSIRKQEWTAII
PNSQLIVIPYPHNVPRSWSAKLYLTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKADD
REKRQEAHRFHFDAM
Download sequence
Identical sequences ENSGGOP00000002955 ENSGGOP00000021607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]