SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021758 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021758
Domain Number 1 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 503-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 1-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 810-867
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 699-756
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.31e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 866-923
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 755-811
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 11 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 13 Region: 912-964
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 14 Region: 466-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000143
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 15 Region: 185-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000796
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 16 Region: 270-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000131
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 17 Region: 550-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000091
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021758   Gene: ENSGGOG00000027143   Transcript: ENSGGOT00000030852
Sequence length 969
Comment pep:known_by_projection chromosome:gorGor3.1:19:50780662:50799743:1 gene:ENSGGOG00000027143 transcript:ENSGGOT00000030852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMKEVSS
TAQGNTEVIHTGTLQRHEHHHIGDFCFQEMEKDIHDFEFQWKEDERNSHEAPMTEIKQLT
GSTNRHDQRHAGNKPIKDQLGSSFHSHLPELHMFQTEGKIGNQVEKSINNASSVSTSQRI
SCRPKTHISNNYGNNFLNSSLLTQKQEVHMREKSFQCNESGKAFNYSSVLRKHQIIHLRA
KQYKCDVCGKVFNQKRYLTCHRRCHTGKKPYKCNDCGKTFSQELTLTCHHRLHTGEKHYK
CSECGKTFSRNSALVIHKAIHTGEKSYKCNECGKTFSQTSYLVYHRRLHTGEKPYKCEEC
DKAFSFKSNLERHRKIHTGEKPYKCNECSRTFSRKSSLTRHRRLHTGEKPYKCNDCGKTF
SQMSSLVYHRRLHTGEKPYKCEECGEAFSFKSNLERHRRIHTGEKPYKCNECGKTFSQTS
SLVYHRRLHTGEKPYKCEECDEAFSFKSNLERHRIIHTGEKLYKCNECGKTFSRKSSLTR
HRRLHTGEKPYQCNECGKAFRGQSALIYHQAIHGIGKLYKCNDCHQVFSNATTIANHWRI
HNEERSYKCNRCGKFFRHRSYLAVHWRTHSGEKPYKCEECDEAFSFKSNLQRHRRIHTGE
KPYRCNECGKTFSRKSYLTCHRRLHTGEKPYKCNECGKTFGRNSALIIHKAIHTGEKPYK
CNECGKTFSHTSSLTCHHRLHTGEKPYKCEECDETFRYKSNLERHRRIHSGEKPYKCNEC
GKTFSQKSCLTRHHRLHTGNKSKCNECGKTFRHSSYLAVHGRTHAGEKPYKCNECGRMFS
QNLALVIHKAIHTGEEPYKCNECGKVFNRKAKLAHHHRLHTGENAYKCNKCGKVFNQQAH
LARHHRTHTGEKPYKCNECGKTFRHNSVLVIHKTIHTGEKPYKCNECGEVFNRKAKLARH
HRIHTGKKH
Download sequence
Identical sequences ENSGGOP00000021758 ENSGGOP00000021190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]