SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021870 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021870
Domain Number 1 Region: 1544-1818
Classification Level Classification E-value
Superfamily Cullin homology domain 5.1e-41
Family Cullin homology domain 0.00079
Further Details:      
 
Domain Number 2 Region: 1143-1299
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.66e-36
Family APC10-like 0.0057
Further Details:      
 
Domain Number 3 Region: 366-440
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.62e-32
Family CPH domain 0.000014
Further Details:      
 
Domain Number 4 Region: 2220-2273
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000689
Family RING finger domain, C3HC4 0.0042
Further Details:      
 
Domain Number 5 Region: 136-198,510-526,692-807,987-1078
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000244
Family RPA1889-like 0.094
Further Details:      
 
Domain Number 6 Region: 2061-2146
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000023
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000021870
Domain Number - Region: 1847-1945
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00254
Family SCF ubiquitin ligase complex WHB domain 0.057
Further Details:      
 
Domain Number - Region: 2133-2201
Classification Level Classification E-value
Superfamily RING/U-box 0.00388
Family IBR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021870   Gene: ENSGGOG00000005599   Transcript: ENSGGOT00000028001
Sequence length 2509
Comment pep:known_by_projection chromosome:gorGor3.1:6:44450126:44503880:1 gene:ENSGGOG00000005599 transcript:ENSGGOT00000028001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGERHAGDLMVPLGPRLQAYPEELIRQRPGHDGHPEYLIRWSVLKCGEVGKVGVEEGKA
EHILMWLSAPEVYANCPGLLGERALSKGPQREPAGVSGSFPRDPGGLDEVAMGEMEADVQ
ALVRRAARQLAESGTPSLTAAVLHTIHVLSAYASIGPLTGVFRETGALDLLMHMLCNPEP
QIRRSAGKMLQALAAHDAGSRAHVLLSLSQQDGIEQHMDFDSRYTLLELFAETTSSEEHC
MAFEGIHLPQIPGKLLFSLVKRYLCVTSLLDQLNSSPELGAGDQSSPCATREKSRGQREL
EFSMAVGNLISELVRSMGWARNLSEQGMSPPRPTRSIFQPYISGPSLLLPTIVTTPRRQG
WVFRQRSEFSSRSGYGEYVQQTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGIPPVQVFW
QSTGRTYWVHWHMLEILGPEEATEDKASAAVEKGAGATVLGTAFPSWDWNPMDGLYPLPY
LQPEPQKNERVGYLTQAEWWELLFFIKKLDLCEQQPIFQNLWKNLDETLGEKALGEISVS
VEMAESLLQVLSSRFEGSTLNDLLNSQIYTKYGLLSNEPSSSSTSRNHSCTPDPEEESKS
EASFSEEETESPKAKAEAPKTEAEPTKTRTEPPMAQSDSQLFNQLLVTEGMTLPTEMKEA
ASEMARALRGPGPRSSLDQHVAAVVATVQISSLDTNLQLSGLSALSQAVEEVTERDHPLV
RPDRSLREKLVKMLVELLTNQVGEKMVVVQALRLLYLLMTKHEWRPLFAREGGIYAVLVC
MQEYKTSVLVQQAGLAALKMLAVANSSEIPTFVTGRDSIHSLFDAQMTREIFASIDSATR
PGSESLLLTVPAAVILMLNTEGCSSAARNGLLLLNLLLCNHHTLGDQIITRELRDTLFRH
SGIAPGTEPMPTTRTILMMLLNRYSEPPGSPERAALETPIIQGQDGSPELLIRSLVGGPS
AELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVIT
RLLDFPEAMVLPWHEVLEPCLNCLSGPSSDSEIVQELTCFLHCLASMHKDYAVVLCCLGA
KEILSKVLDKHSAQLLLGCELRDLVTECEKYAQLYSNLTSSILAGCIQMVLGQIEDHRRT
HQPINIPFFDVFLRHLCQGSSVEVKEDKCWEKVEVSSNPHRASKLTDHNPKTYWESNGST
GSHYITLHMHRGVLVRQLTLLVASEDSSYMPARVVVFGGDSTSCISTELNTVNVMPSASR
VILLENLNRFWPIIQIRIKRCQQGGIDTRVRGVEVLGPKPTFWPLFREQLCRRTCLFYTI
RAQAWSRDIAEDHRRLLQLCPRLNRVLRHEQNFADRFLPDDEAAQALGKTCWEALVSPLV
QNITSPDAEGVSALGWLLDQYLEQRETSRNPLSRAASFASRVRRLCHLLVHVEPPPGPSP
EPSSRPFSKNSKGRDRSPAPSPVLPSSSLRNITQCWLSVVQEQVGRFLAAAWRAPDFVPR
YCKLYEHLQRAGSELFGPRAAFTLALRSGFSGALLQQSFLTAAHMSEQFARYIDQQIQGG
LIGGAPGVEMLGQLQRHLEPIMVLSGLELATTFEHFYQHYMADRLLSFGSSWLEGAVLQQ
IGLCFPNRLPQLMLQSLSTSEELQRQFHLFQLQQLDKLFCERRLDQEEEEEEEAEKELFI
DDPSPAISILVLSPRCWPVSPLCYLYHPRKCLPTEFCDALDRFSSFYSQSQNHPVLDMGP
HRRLQWTWLGRAELQFGNQTLHVSTVQMWLLLKFNQTEEVSVETLLKDSDLSPELLLQAL
VPLTSGNGPLTLHEGQDFPHGGVLRLHEPGPQRSGEALWLIPPQAYLNVEKDEGRTLEQK
RNLLSCLLVRILKAHGEKGLHIDQLVCLVLEAWQKGPNPPGTLGHTVAGGVACTSTDVLS
CILHLLGQGYVKRRDDRPQILMYAAPEPMGPCRGQADVPFCGSQSETSKPSPEAVATLAS
LQLPAGRTMSPQEVEGLMKQTVRQVQETLNLEPDVAQHLLAHSHWGAEQLLQSYSEDPEP
LLLAAGLCVPQAQAVPVRPDHCPVCVSPLGCDDDLPSLCCMHYCCKSCWNEYLTTRIEQN
LVLNCTCPIADCPAQPTGDFIRAIVSSPEVISKYEKALLRGYVESCSNLTWCTNPQGCDR
ILCRQGLGCGTTCSKCGWASCFNCSFPEAHYPASCGHMSQWVDDGGYYDGMSVEAQSKHL
AKLISKRCPSCQAPIEKNEGCLHMTCAKCNHGFCWRCLKSWKPNHKDYYNCSAMVSKAAR
QEKRFQDYNERCTFHHQAREFAVNLRNRVSAIHEVPPPRSFTFLNDACQGLEQARKVLAY
ACVYSFYSQDAEYMDVVEQQTENLELHTNALQILLEETLLRCRDLASSLRLLRADCLSTG
MELLRRIQERLLAILQHSAQDFRVGLQSPSVEAWEAKGPNMPGSQPQASSGPEAEEEEED
HEDDVPEWQQDEFDEELDNDSFSYDESENLDQETFFFGDEEEDEDEAYD
Download sequence
Identical sequences ENSGGOP00000021870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]