SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021912 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021912
Domain Number 1 Region: 322-543
Classification Level Classification E-value
Superfamily vWA-like 6.85e-52
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 162-351
Classification Level Classification E-value
Superfamily vWA-like 6.68e-43
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 3 Region: 29-124
Classification Level Classification E-value
Superfamily LCCL domain 3.92e-28
Family LCCL domain 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021912   Gene: ENSGGOG00000025198   Transcript: ENSGGOT00000033521
Sequence length 550
Comment pep:known_by_projection chromosome:gorGor3.1:14:12014939:12030658:1 gene:ENSGGOG00000025198 transcript:ENSGGOT00000033521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAWIPALGLGVCLLLLPGPAGSEGAAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFS
VYGNIVYASVSSICGAAVHRGVISNSGGPVRVYSLPGRENYSSVDANGIQSQMLSRWSAS
FTVTKGKSSTQEATGQAVSTAHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRR
FNLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLKNFTSAKDVLFAIKEVGFRGG
NSNTGKALKHTAQKFFTVDAGVRKGIPKVVVVFIDGWPSDDIEEAGIVAREFGVNVFIVS
VAKPIPEELGMVQDVTFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMCSK
TCYNSVNIAFLIDGSSSVGDSNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEFS
FTDYSTKENVLAVIRNIRYMSGGTATGDAISFTVRNVFGPIRESPNKNFLVIVTDGQSYD
DVQGPAAAAHDAGITIFSVGVAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVIRG
ICRDFLESQQ
Download sequence
Identical sequences A0A2I2YYV4 A0A2I3SPC0 O43405
gi|205277471|ref|NP_001128530.1| gi|4758022|ref|NP_004077.1| ENSP00000216361 ENSP00000379862 ENSPTRP00000010586 ENSGGOP00000021912 ENSP00000216361 ENSP00000216361 ENSP00000379862 ENSGGOP00000021912 9598.ENSPTRP00000010586 9606.ENSP00000216361 NP_001128530.1.87134 NP_001128530.1.92137 NP_004077.1.87134 NP_004077.1.92137 XP_001171057.1.37143 XP_004055095.1.27298 XP_008972946.1.60992 ENSPTRP00000010586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]