SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021939 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021939
Domain Number 1 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 1-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-23
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 4 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 475-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000123
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 382-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000144
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 189-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000149
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021939   Gene: ENSGGOG00000004172   Transcript: ENSGGOT00000003367
Sequence length 522
Comment pep:known_by_projection chromosome:gorGor3.1:19:50844330:50858229:1 gene:ENSGGOG00000004172 transcript:ENSGGOT00000003367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKRLMKEFLS
TGQGNREVIHTGTLQRHESHHIGDFCFQKIEKDIHGFQFQWQEDETNGHEAPMTKIKKLT
GSAERYDQNYAGNKPIKYQLGFSFHSHLPELHIFHTEEKIDNHVEKSINDASSVSTAQRI
YCRPETHISNDYGNNFLNSSLFTQKQEVHMREKSFQCNDSGKAYNYSSLLRKHQLIHLGE
KQYKCDICGKVFNSKRYVARHRRCHTGEKPYKCNECGKTFSQTYYLTCHRRLHTGEKPYK
CEECDKAFHFKSKLQIHRRIHTGEKPYKCNVCDKAFGHDSHLAQHARIHTGEKPYQCNEC
GKAFSHKSSLTYHRRLHTEEKPYKCNECGKTFNQQLTLKCHCRLHSGEKPYECEECDKAY
SFKSNLEIHQKIHTEENPYKCNECGKTFSRTSSLTYHRRLHTGQKPYKCEDCDEAFSFKS
NLERHRRIYTGEKYTCNECGKTFNQELTLTCHRRLHSGEKPY
Download sequence
Identical sequences ENSGGOP00000021939 ENSGGOP00000017073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]