SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022016 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022016
Domain Number 1 Region: 162-234
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-19
Family Complement control module/SCR domain 0.0000225
Further Details:      
 
Domain Number 2 Region: 223-284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.37e-16
Family Complement control module/SCR domain 0.0000118
Further Details:      
 
Domain Number 3 Region: 98-172
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000111
Family Complement control module/SCR domain 0.0000313
Further Details:      
 
Domain Number 4 Region: 36-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000216
Family Complement control module/SCR domain 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022016   Gene: ENSGGOG00000022844   Transcript: ENSGGOT00000029700
Sequence length 384
Comment pep:known_by_projection chromosome:gorGor3.1:1:187314282:187348889:1 gene:ENSGGOG00000022844 transcript:ENSGGOT00000029700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTV
ITYKCEEGFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFP
VGTIVEYECRPGYMREPSLSTKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPSGI
LFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGER
DHYGYRQSITYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGNGTTSGTTRLLS
ALQVRPFEVSGSSHISSKKMMCIL
Download sequence
Identical sequences ENSGGOP00000022016 ENSGGOP00000027405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]