SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022037 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022037
Domain Number 1 Region: 90-104,239-477
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-67
Family Nuclear receptor ligand-binding domain 0.00000000273
Further Details:      
 
Domain Number 2 Region: 22-105
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-30
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022037   Gene: ENSGGOG00000010226   Transcript: ENSGGOT00000023310
Sequence length 479
Comment pep:known_by_projection chromosome:gorGor3.1:1:179927524:180058432:1 gene:ENSGGOG00000010226 transcript:ENSGGOT00000023310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLTPTLSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTC
IENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQK
KALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVT
SPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIP
HLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARS
SIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGA
TLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALL
DYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA
Download sequence
Identical sequences ENSGGOP00000022037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]