SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022079 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022079
Domain Number 1 Region: 251-326
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.72e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000294
Further Details:      
 
Domain Number 2 Region: 95-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.88e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 8-82
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.31e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022079   Gene: ENSGGOG00000012613   Transcript: ENSGGOT00000027186
Sequence length 335
Comment pep:known_by_projection chromosome:gorGor3.1:12:51480941:51508426:1 gene:ENSGGOG00000012613 transcript:ENSGGOT00000027186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIIT
LAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTI
PYRPKPSSSPVIFAGGQAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESS
SPEVKGYWAGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGS
TDRQVTITGSAASISLAQYLINVRLSSETGGMGSS
Download sequence
Identical sequences A0A1S3GGV7 A0A2I2U3P8 A0A2I3MT21 A0A2J8KD13 A0A2J8SX40 A0A2K5VMT1 A0A2K5YSW6 A0A2K6BXQ0 A0A2K6GKC7 A0A2K6M3Y7 K9IZY8 Q4V8F6
ENSP00000394116 ENSP00000449062 ENSP00000394116 ENSP00000449062 gi|193083112|ref|NP_001122385.1| NP_001122385.1.87134 NP_001122385.1.92137 XP_004374026.1.4749 XP_004583232.1.84141 XP_004601591.1.94378 XP_004637954.1.9945 XP_004716924.1.18182 XP_005902184.1.15283 XP_006047553.1.26621 XP_006169141.1.99106 XP_006242485.1.100692 XP_006520647.1.92730 XP_006870021.1.41390 XP_006933809.1.62641 XP_006981899.1.50099 XP_007179526.1.59432 XP_007631664.1.28591 XP_007947703.1.48129 XP_008001641.1.81039 XP_008138983.1.99482 XP_008525648.1.77740 XP_008574073.1.73410 XP_008702878.1.72690 XP_008836944.1.79516 XP_009246078.1.23681 XP_010348202.1.74449 XP_010607649.1.5607 XP_010803185.1.76553 XP_010856241.1.44457 XP_010962689.1.22495 XP_011228243.1.58354 XP_012004688.1.54773 XP_012384057.1.11602 XP_012508634.1.63892 XP_012619313.1.48125 XP_012887945.1.60039 XP_012923928.1.39548 XP_013213918.1.77405 XP_013839542.1.46622 XP_013963916.1.84170 XP_014317286.1.53796 XP_014397550.1.60319 XP_014596397.1.31192 XP_014642031.1.5094 XP_014703048.1.49734 XP_014936755.1.86478 XP_014950123.1.66739 XP_015093667.1.17985 XP_015286190.1.63531 XP_016056849.1.3490 XP_016778816.1.37143 XP_017197399.1.1745 XP_017512045.1.32401 XP_017706478.1.44346 XP_017903159.1.57651 XP_018894063.1.27298 XP_019275098.1.44245 XP_019515261.1.44202 XP_019580010.1.88060 XP_019816008.1.53367 XP_020015884.1.5219 XP_020750754.1.74333 XP_021499212.1.76796 XP_021521693.1.9421 XP_021542387.1.83697 ENSGGOP00000022079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]