SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022120 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022120
Domain Number 1 Region: 713-824
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000514
Further Details:      
 
Domain Number 2 Region: 156-261
Classification Level Classification E-value
Superfamily SRCR-like 1.29e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 928-1031
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000883
Further Details:      
 
Domain Number 4 Region: 264-368
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 5 Region: 50-154
Classification Level Classification E-value
Superfamily SRCR-like 7.46e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 6 Region: 476-580
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00048
Further Details:      
 
Domain Number 7 Region: 580-687
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00073
Further Details:      
 
Domain Number 8 Region: 371-475
Classification Level Classification E-value
Superfamily SRCR-like 1.11e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 
Domain Number 9 Region: 820-927
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022120   Gene: ENSGGOG00000024564   Transcript: ENSGGOT00000024385
Sequence length 1161
Comment pep:known_by_projection chromosome:gorGor3.1:12:7685823:7707705:-1 gene:ENSGGOG00000024564 transcript:ENSGGOT00000024385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLRMVLLEDSGSADFRRHFVNLSPFTITVVLLLSACFVTSSLGGTDKELRLVDGENKC
SGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKATGWANSSAGSGRIWMDHVSC
RGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLMNGGNMCSGRIEIKFQGRW
GTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKH
QGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDA
AVACKQLGCPTAITAIGRVNASEGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNED
AGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGLKEADVVCRQLGCGSAL
KTSYQVYSKIQATNTWLFLSSCNGNETSLWDCKNWQWGGLTCDHYEEAKITCSAHREPRL
VGGDIPCSGRVEVKHGDMWGSVCDSDFSLEAASVLCRELQCGTVVSILGGAHFGEGNGQI
WAEEFQCEGHESHLSLCPVAPRPEGTCSHSRDVGVVCSRYTEIRLVNGKTPCEGRVELKT
LGAWGSLCNSHWDIEDAHVLCQQLKCGVALSTPGGAHFGKGNGQVWRHMFHCTGTEQHMG
DCPVTALGASLCPSEQVASVICSGNQSQTLSSCNSSSLGPTRPTIPEESAVACIESGQLR
LVNGGGRCAGRVEIYHEGSWGTICDDNWDLSDAHVVCRQLGCGEAINATGSAHFGEGTGP
IWLDEMKCNGKESRIWQCHSHGWGQQNCRHKEDAGVICSEFMSLRLTSEASREACAGRLE
VFYNGAWGSVGKSSMSETTVGVVCRQLGCADKGKINPASLDKAMSIPMWVDNVQCPKGPD
TLWQCPSSPWEKRLASPSEETWITCDNKIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDL
DDAQVVCQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHNECGH
KEDAAVNCTHISVQKTPQKATTGRSSHQSSFIAVGILGVVLLAIFVALFFLTKKRRQRQQ
LAVSSRGENLVHQIQYREMNSCLNADDLDLMNSSGLWVLGGSIAQGFRSVAAIEAQTFYF
DKQFKKSKNVIGSLDAYNGQE
Download sequence
Identical sequences ENSGGOP00000022120 ENSGGOP00000022120 XP_018894866.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]