SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022134 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022134
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily PR-1-like 5.89e-47
Family PR-1-like 0.000000051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022134   Gene: ENSGGOG00000003324   Transcript: ENSGGOT00000025403
Sequence length 154
Comment pep:known_by_projection chromosome:gorGor3.1:9:36879499:36906481:1 gene:ENSGGOG00000003324 transcript:ENSGGOT00000025403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSASKQFHNEVLKAHNEYRQKHGVPPLKLCKKLNQEAQQYSEALASTRILKHSPESSR
GQCGENLAWASYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKA
SASDGSSFVVARYFPAGNVVNEGFFEENVLPPKK
Download sequence
Identical sequences G3S237
XP_004048061.1.27298 ENSGGOP00000022134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]