SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022274 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022274
Domain Number 1 Region: 177-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000547
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022274   Gene: ENSGGOG00000024357   Transcript: ENSGGOT00000022902
Sequence length 567
Comment pep:known_by_projection chromosome:gorGor3.1:17:7795131:7819217:-1 gene:ENSGGOG00000024357 transcript:ENSGGOT00000022902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLASGGDVEPGLPVEVRGSNGAFYKVYSRANEQEPCGWWLARVRMMKGDFYVIEYAAC
DATYNEIVTLERLRPVNPNPLATKGSFFKVTMAVPEDLREACSNENVHKEFKKALGANCI
FLNITNSELFILSTTEAPVKRASLLGDMHFRSLRTKLLLMSRNEEATKHLETPEACRQAR
SYLEFSEDSVQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPREEGMVPFI
FVGTRENISNAQALLEYHLSYLQEVEQLRLERLQIDEQLRQIGLGFRPPGSGRGSGGSDK
AGYSTDESSSSSLHATRTYGGSYGGRGRGRRTGGPAYGPSSDVSTASETESEKREEPNRA
GPGDRDPPTRGEESRRRPTGGRGRGPPPAPRPTSRYNSSSISSVLKDPDSNPYSLLDTSE
PEPPVDSEPGEPPPASARRRRSRRRRTDEDRTVMDGGLESDGPNMTENGLEDESRPQRRN
RSRRRRNRGNRTDGSISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDSLSGQKGDSV
SKLPKGPSENGELSAPLELGSMVNGVS
Download sequence
Identical sequences ENSGGOP00000022274 ENSGGOP00000022274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]