SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022332 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022332
Domain Number 1 Region: 238-290
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000404
Family RING finger domain, C3HC4 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022332   Gene: ENSGGOG00000028362   Transcript: ENSGGOT00000026585
Sequence length 305
Comment pep:known_by_projection chromosome:gorGor3.1:8:75411152:75417199:-1 gene:ENSGGOG00000028362 transcript:ENSGGOT00000026585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRKENAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACL
WVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTVGGRWLEERC
YDLFRNHHLASFGKVKQCVNFVIGLLKLGGLINFLIFLQRGKFATLTERLLGIHSVFCKP
QNIREVGFEYMNRELLWHGFAEFLIFLLPLINVQKLKAKLSSWCIPLTGAPNSDNTLATS
GKECALCGEWPTMPHTIGCEHIFCYFCAKSSFLFDMYFTCPKCGTEVRSLQPLKSGIEMS
EVNAL
Download sequence
Identical sequences A0A2I2Z8W1
ENSGGOP00000022332 ENSGGOP00000022332 XP_004047220.1.27298 XP_004047221.1.27298 XP_018888252.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]