SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022347 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022347
Domain Number 1 Region: 714-969
Classification Level Classification E-value
Superfamily RNI-like 1.28e-48
Family 28-residue LRR 0.0000785
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 2.71e-21
Family Pyrin domain, PYD 0.00000353
Further Details:      
 
Domain Number 3 Region: 1378-1464
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-17
Family Caspase recruitment domain, CARD 0.021
Further Details:      
 
Domain Number 4 Region: 313-415,450-498
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000412
Family Nucleotide and nucleoside kinases 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022347   Gene: ENSGGOG00000011464   Transcript: ENSGGOT00000023398
Sequence length 1475
Comment pep:known_by_projection chromosome:gorGor3.1:17:5627074:5700366:-1 gene:ENSGGOG00000011464 transcript:ENSGGOT00000023398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQ
YGEQRAWDLALHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSKPTSTAVLMPW
IHELPAGCTQGSERRVLRQLPDTSGRRWREISASLLYQALPSSPDHESPSQESPNAPTST
AVLGSWGSPPQPSLAPREQEAPGTQWPLDETSGIYYTEIREREREKSEKGRPPWAAVVGT
PPQAHASLQPHHHPWEPSVRESLCSTWPWKNEDLNQKFTQLLLLQRPHPRSQDPLVKRSW
PDYVEENRGHLIEIRDLFGPVLDTQEPRVVILQGAAGTGKSTLAMQVKEAWGRGQLYGDR
FQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQ
EPSSELCLHWSQPQPADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLG
FSESSRKEYFYKYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKRKEKL
TLTSKTTTTLCLHYLSQALQAQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAI
ISTLLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYVLEDKKGRGKHSNCIIDLEKMLEAY
GIHGLFGASTTRFLLGLLSDEGEREMENIFHCQLSQGRNLMQWVPSLQLLLQPHSLESLH
CLYETRNKTFLTKVMAHFKEMGMCVETDMELLVCTFCIKFSRHVKKLQLIEGRQHRSTWS
PTMVVLFRWVPVTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLE
ILRLAGCGLIAQDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQ
LVSCGLTSDCCQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQ
TTLSDEMRQELRALEQEKPQLLIFSRRKPSVMTPIEGLDTGEMSTSSLKRQRLGSVHLLN
HVLSQPAHLGMLGRVALLFQWGRGVSEESSPEVVPVELLCVPSPASQGDLHTKPLGTDDD
FWGPTGPVATEVVDKEKNLYRVHFPVAGSYRWPNTGLCFVVREAVTVEIELCVWDQFLGE
INPRHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQVAHFKEEGMLLEKPA
RVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRLHPEEVTFHLYLIPSDCS
IRKAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGEDQ
LFSEFYVGHLGSGIRLQVKDKRDETLVWEALVKPGDLMPATTLVPPARIAVPSPLDAPRL
LHFVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDR
KCKDRLYQALKETHPHLIMELWEKGSKKGLLPLSS
Download sequence
Identical sequences ENSGGOP00000022347 ENSGGOP00000011186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]