SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022607 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022607
Domain Number 1 Region: 401-487
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.53e-23
Family Canonical RBD 0.0027
Further Details:      
 
Domain Number 2 Region: 28-66
Classification Level Classification E-value
Superfamily SAP domain 0.0000000106
Family SAP domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022607   Gene: ENSGGOG00000015093   Transcript: ENSGGOT00000033425
Sequence length 933
Comment pep:known_by_projection chromosome:gorGor3.1:19:5736018:5777246:-1 gene:ENSGGOG00000015093 transcript:ENSGGOT00000033425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XETLPGSGDSGPGTASLGAGVAESGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERLK
KAVKEEGQDPDEIGIELEATSKKSAKRCVKGLKMEEEGTEDNGLEDDSRDGQEDMEASLE
NLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEHA
VDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFA
QDTSSVGPDRKLAEEEDLFDSAHPEEGDLDLASESTAHAQSSKADSLLAVVKREPAEQPG
DGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSKEDGRKFDFDAC
NEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVSSSSGRNLWVSGLSSTTRAT
DLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTSDEATKCISHLHRTELHGRMISVE
KAKNEPAGKKLSDRKECEVKKEKLSSVDRQTVIKKEEKIEKKEEKQAEDIKKEEKDQDEL
KPGPTNRSRVTKSEGSRGMERTVVMDKSKGEPVISVKTTSRSKERSSKSQDRKSESKEKR
HLVICERMCVERERRKEQERSHREEREQREREQRLEAFHERKEKARLQRERLQLECQRQK
EQERMRVERERRKEQERMRVERERRKEQELIHREREELRRQQEQPRYEQERRPGRRPYDL
DRIKTNRRDDAYWPEGKRVAMEDRYRADFPRPDHRFHDFDHRDRGQYQDHAIDRREGSRP
MMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGWGGYGSDKRLSEGRGLPPPPRQRGGRDW
GEHNQRLEEHQARAWQGAMDAGTASREHTRWQGGERGLSGPSGPGHMASRGGVAGRGGFA
QGGHSQGHVVPGGGLEGGGVASQDRGSRFTRRY
Download sequence
Identical sequences ENSGGOP00000022607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]