SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000022649 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000022649
Domain Number 1 Region: 273-333
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000022649
Domain Number - Region: 6-64
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0994
Family Myosin rod fragments 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000022649   Gene: ENSGGOG00000002130   Transcript: ENSGGOT00000027118
Sequence length 501
Comment pep:novel chromosome:gorGor3.1:13:18077967:18163543:-1 gene:ENSGGOG00000002130 transcript:ENSGGOT00000027118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTPQESLNTLLKQLEKEKRTLESQVKYYALKLEQESKAYQKINNERCTYLAEMSQGSGLH
QVSKRQQMDQLPRMQENLVKTLLLKEESDPLEAKIDILLVGDVTVGYLADTVQKLFANIA
EVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIP
ENFKGCISGHGTDIALTEPLTMEKMSNVVKYWTTCPSNTVKIENATGPEELGLPLQRSYS
EHLGYFPADLFACPESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRERIKYCCEQL
RTLLPYVKGRKNDAASVLEATVDYVKYIREKISPAIMAQITEALQSNMRFCKKQQTPIEL
SLPGTVMAQRENSVMSTYSPERGLQFLTNTCWNGCSTPDAESSLDEAVRVPSSSTSENAI
GDPYKTHIPSAALSLNSLHTVRYYSKVTPSYDATAVTNQNISIHLPSAVPPVSKLLPRHC
TSGLGQTCTTHPNCLQQFWAY
Download sequence
Identical sequences ENSGGOP00000018929 ENSGGOP00000022649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]