SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023349 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023349
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.56e-20
Family Canonical RBD 0.0000291
Further Details:      
 
Domain Number 2 Region: 457-536
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000133
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 3 Region: 364-448
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000347
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 4 Region: 265-352
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000729
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 5 Region: 185-255
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000076
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023349   Gene: ENSGGOG00000024907   Transcript: ENSGGOT00000033034
Sequence length 545
Comment pep:known_by_projection chromosome:gorGor3.1:1:125906108:125907772:1 gene:ENSGGOG00000024907 transcript:ENSGGOT00000033034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLFIGNLSPAVTAEDLRQLFGDRELPLAGQVLLKSRYAFVDYPDQNWAIRTIETPSGQ
VELHGKIMEVDYSVSIKLRSRNIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETA
VVNVTYATKEEVKIAMKKLIGHQFENYSFKISYIPDEERAQRGDHSSWEQGQAPGGSSQA
RQIDFPLRILVATQFVGAIIGKEGLTIKNITKQSQSRVDIYRQENSGAAEKPVTIHATPE
WTSEACRMILEVMQKEADEAKLAEEIPLKILAHNGLVGRLIGKEGRNLKKNEHETGTKIT
ISSSQDLSIYNPERTVTVKGTVEVCASAEIEIMKKLREAFENDTLTVNIHFGYFSSLYPH
HQFGPFQHHHSYPEQKIVNLFIPTQGVGAIIGKKGAHIKQLARFVGASIKIAPAEGPDQR
KVIITWPPESQFKAQGRIFGKLKEENFFNPKEEVKLETHIRVPSSTAGQVIGKGGKTVNE
LQNLISAEVIVPRDQTPDENEEMIVRIIGHFFASQTAQRKIRETVQQVKQQEQKYPQGVA
SQRSK
Download sequence
Identical sequences ENSGGOP00000023349 ENSGGOP00000023349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]