SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023445 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023445
Domain Number 1 Region: 327-397
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000154
Further Details:      
 
Domain Number 2 Region: 5-79
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.08e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023445   Gene: ENSGGOG00000000325   Transcript: ENSGGOT00000025949
Sequence length 411
Comment pep:known_by_projection chromosome:gorGor3.1:19:43160721:43182309:-1 gene:ENSGGOG00000000325 transcript:ENSGGOT00000025949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLVQGT
AEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRAKQTCLPLPAITGSDLSDS
SATSRRVYKWPLILLPSIINMLWFYNSGSIMKVPATCGHAWISSSPNSPHTLHLDSPVVN
KSGRPTGNRAWGALSQRHPLSPTKGTCLMKAFPGLEVRVYNTRRHGSPATVKTLPSPAAA
SGLLGPAGLAGVGAFPAALPAFSGTDLLAISTALNTLASYGYNTNSLGLGLNYLLASGAL
GSFALAAAANGYFLTAEKLAAESAKELVEIAVPENLVGAILGKGGKTLVEYQELTGARIQ
ISKKGEFLPGTRNRRVTITGSPAATQAAQYLISQRVTYEQGVRASNPQKVG
Download sequence
Identical sequences ENSGGOP00000023445 ENSGGOP00000000319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]