SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023732 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023732
Domain Number 1 Region: 1026-1293
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.27e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000701
Further Details:      
 
Domain Number 2 Region: 182-506
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.18e-66
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000217
Further Details:      
 
Domain Number 3 Region: 508-711
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 4.81e-53
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.00042
Further Details:      
 
Domain Number 4 Region: 1296-1425
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.45e-29
Family Anticodon-binding domain of Class II aaRS 0.00015
Further Details:      
 
Domain Number 5 Region: 1429-1516
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 1.88e-17
Family C-terminal domain of ProRS 0.0057
Further Details:      
 
Domain Number 6 Region: 756-809
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 1.14e-16
Family a tRNA synthase domain 0.0000505
Further Details:      
 
Domain Number 7 Region: 51-161
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.26e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.02
Further Details:      
 
Domain Number 8 Region: 828-882
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000165
Family a tRNA synthase domain 0.00012
Further Details:      
 
Domain Number 9 Region: 908-959
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000000471
Family a tRNA synthase domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023732   Gene: ENSGGOG00000012404   Transcript: ENSGGOT00000033319
Sequence length 1516
Comment pep:known_by_projection chromosome:gorGor3.1:1:200280979:200359360:-1 gene:ENSGGOG00000012404 transcript:ENSGGOT00000033319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATLCLTVNSGDPPLGALLAVEHVKDDVSISVEEGKENILHVSENVIFTDVNSILRYLAR
VATTAGLYGSNLMEHTEIDHWLEFSATKLSSCDSFTSAINELNHCLSLRTYLVGNSLSLA
DLCVWATLKGNAAWQEQLKQKKAPVHVKRWFGFLEVQQAFQSVGTKWDVSTTKARVAPEK
KQDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTN
PEKEKEDFEKVIKSVVMTLCQKSEKYHLTEEHIFLIHGFSPELLKIQEYPASHWDDKGAF
REPMSSDSQPELCSLDRHAIEKNLQMWEEMKKGSQFGQSCCLRAKIDMSSNNGCMRDPTL
YRCKIQPHPRTGNKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIR
KPYIWEYSRLNLNNTVLSKRKLTWFVNEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIA
AQGSSRSVVNMEWDKIWAFNKKVIDPVAPRYVALLKKEVIPVNVPEAQEEMKEVAKHPKN
PEVGLKPVWYSPKVFIEGADAETFLEGEMVTFINWGNLNITKIHKNADGKIISLDAKLNL
ENKDYKKTTKITWLAETTHALPIPVICVTYEHLITKPVLGKDEDFKQYVNKNSKHEELML
GDPCLKDLKKGDIIQLQRRGFFICDQPYEPVSPYSCKEAPCVLIYIPDGHTKEMPTSGSK
EKTKVEATKNETSAPFKERPTPSLNNNCTTSEDSLVLYNRVAVQGDVVRELKAKKAPKED
VDAAVKQLLSLKAEYKEKTGQEYKPGNPPAEIGQNISSNSSASILESKPLYDEVAAQGEV
VRKLKAEKAPKAKINEAVECLLSLKAQYKEKTGKEYISGQPPLSQSSDSSPTRNSEPAGL
ETPEAKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSAT
GAEDKDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSSGAGEGQGPKKQTRLGL
EAKKEENLADWYSQVITKSEMIEYHDVSGCYILRPWAYAIWEAIKDFFDAEIKKLGVENC
YFPMFVSQSALEKEKTHIADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQS
HRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVLQILDLYAQV
YEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQNFSKMFEIVF
EDPKTPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVIIPCGITNALS
EEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKS
CQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVANTMEDFQKI
LDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCELQPGAKCV
CGKNPAKYYTLFGRSY
Download sequence
Identical sequences ENSGGOP00000023732 ENSGGOP00000012123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]