SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023770 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023770
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-25
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.53e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 523-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 383-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 307-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-16
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 7 Region: 197-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000394
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 8 Region: 263-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000909
Family Classic zinc finger, C2H2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023770   Gene: ENSGGOG00000028417   Transcript: ENSGGOT00000031148
Sequence length 580
Comment pep:novel chromosome:gorGor3.1:16:32467052:32515076:1 gene:ENSGGOG00000028417 transcript:ENSGGOT00000031148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLTFRDVAVEFSLEEWEHLEPAQKNLYQDVMLENYRNLVSLGLVVSKPDLITFLEQRK
EPWNVKSEETVAIQPDVFSHYNKDLLTEHCTEASFQKVISRRHGSCDLENLHLRKRWKRE
ECEGHNGCYDEKTFKYDQFDESSVESLFHQQILSSCAKSYNFDQYRNVFTHSSLLNQQEE
IDIWGKHHIYDKTSVLFRQVSTLNSYRNVFIGEKNYHCNNSEKTLNQSSSPKNHQENYFL
ENQYKCKEFEKVFLQSMHGQEKQEQSYKCNKCVEVCTQSLKHTQHQTIHIRENSYRYNKY
DKDLSQSSNLRRQIIHNEEKPYKCEKCGDRFNHSLHLTQHQIIPTKEKPYKWKECGKVFN
LNCSLYLTKQQQIDTGENLYKCKACSCKECGKAFPYSSHLIRHHRIHTGEKPYKCKACSK
SFSDSSGLTVHRRTHTGEKPYTCKECGKAFSYSSDVIQHRRIHTGQRPYKCEECGKAFNY
RSYLTTHQRSHTGERPYKCEECGKAFNSRSYLTTHRRSHTGERPYKCDECGKAFSYRSYL
TTHRRSHSGERPYKCEECGKAFNSRSYLITHQRSHTREKL
Download sequence
Identical sequences ENSGGOP00000023770 ENSGGOP00000023770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]