SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023868 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023868
Domain Number 1 Region: 29-74
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000836
Family LIM domain 0.0002
Further Details:      
 
Domain Number 2 Region: 2-28
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000642
Family LIM domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023868   Gene: ENSGGOG00000024213   Transcript: ENSGGOT00000023346
Sequence length 76
Comment pep:novel chromosome:gorGor3.1:22:8680552:8680782:1 gene:ENSGGOG00000024213 transcript:ENSGGOT00000023346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKCPACDKVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYGNHPCYAAMF
GPKGFGRGGPESHTFK
Download sequence
Identical sequences ENSGGOP00000023868 ENSGGOP00000023868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]