SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023950 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023950
Domain Number 1 Region: 618-712
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.14e-16
Family Tudor domain 0.0017
Further Details:      
 
Domain Number 2 Region: 484-572
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023950
Domain Number - Region: 674-784
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00942
Family Staphylococcal nuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023950   Gene: ENSGGOG00000011719   Transcript: ENSGGOT00000029620
Sequence length 787
Comment pep:known_by_projection chromosome:gorGor3.1:5:26825760:26841614:-1 gene:ENSGGOG00000011719 transcript:ENSGGOT00000029620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIQFRSLFPLALPGMLALLGWWWFFSRKKGHVSSHDEQQVEAGAVQLRADPAIKEPLPM
EDVCSKVVSTPPSVTEPPEKELSTVSKLPAEPPALLRTHPPCRRSQSSGILPNTTDMRLR
PGTRRDDSTKLELALTGGEAKSIPLECPLSSPKGVLFSSKSAEVCKQDSPFSRVPGKVQP
GYPAVPAEKRSSGERARETEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELA
KDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDGNEEGLDRNEESLDRNEGLDRN
EEIERAAFQIISQVISEATEQKTVLGPDTAEPATAEAAAAPPDAGLPLPGLPAEGSPPPK
TYVSCLKSLLSSPTKDNSSQSVPLVASPGHCSDSFSTSGLEDSCTETSSSPRDKAITPPL
PESTVPFSNGVLKGELSDLGAEDGWTVDAEADHSGGSDRNSMDSMDSCCSLKKTESFQNA
QAGSNPKKVDLIIWEIEVPKHLVGRLIGKQGRYVSFLKQTSGAKIYISTLPYTQSVQICH
IEGSQHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTSWLMLPDGITVEVIVVN
QVNAGHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEITVICAAPGADGAWWR
AQVVASYEETNEVEIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLLDSVMPLSDDD
QFSPEADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWV
DSYYTSL
Download sequence
Identical sequences ENSGGOP00000023950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]