SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023954 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023954
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.62e-34
Family MHC antigen-recognition domain 0.000017
Further Details:      
 
Domain Number 2 Region: 95-183
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-26
Family C1 set domains (antibody constant domain-like) 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023954   Gene: ENSGGOG00000000700   Transcript: ENSGGOT00000028855
Sequence length 232
Comment pep:novel chromosome:gorGor3.1:6:33522865:33531761:-1 gene:ENSGGOG00000000700 transcript:ENSGGOT00000028855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFLEQAKCECHILNGTERVQYLNRYIHKREENLRFDSDVGEFQAVTELGRPVAEKWNSQK
EILEEKRDKVDTYCRYSYGVFESFTVPRLVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPG
SIEVRWFQNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLT
VEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRSQKGHSGLQPTGFLS
Download sequence
Identical sequences ENSGGOP00000023954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]