SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gorilla gorilla 76_3.1 > ENSGGOP00000023974

Domain assignment for ENSGGOP00000023974 from Gorilla gorilla 76_3.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGGOP00000023974
Domain Number 1	Region: 2-173
Classification Level	Classification	E-value
Superfamily	PR-1-like	5.36e-52
Family	PR-1-like	0.00000478
Further Details:

Domain Number 2	Region: 222-278
Classification Level	Classification	E-value
Superfamily	Crisp domain-like	1.2e-17
Family	Crisp domain	0.001
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGGOP00000023974 Gene: ENSGGOG00000024118 Transcript: ENSGGOT00000024796
Sequence length	278
Comment	pep:known_by_projection chromosome:gorGor3.1:6:51249366:51269444:-1 gene:ENSGGOG00000024118 transcript:ENSGGOT00000024796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MALLPVLFLVTVLLPSLPAEGKDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLK MEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDESLD FVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAMKTYLNKR EGINVWKCFLRLRHFQLLRGEQLLAFSGNNMNRKNTPYQQGTPCASCPDDCDKGLCTNSC QYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY
Download sequence
Identical sequences	A0A2I2YLF0 ENSGGOP00000023974 ENSGGOP00000023974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]