SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024079 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024079
Domain Number 1 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.82e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 276-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.74e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 23-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 429-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 233-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024079
Domain Number - Region: 207-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000159
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024079   Gene: ENSGGOG00000013603   Transcript: ENSGGOT00000026005
Sequence length 490
Comment pep:known_by_projection chromosome:gorGor3.1:19:55070138:55164928:1 gene:ENSGGOG00000013603 transcript:ENSGGOT00000026005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALRDPSQVSAASSCPPPNPKGYVTFEDVAVYFSQEEWRLLDDTQRLLYRNVMLENF
TLLASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQSCEMCVPVLKDILHLADLPG
QKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKCCLFCMSLKPFRKWEVGKDLPAML
GLLRSLVFPGGKKPSTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPRVYTGKKLYE
CSKCGKAFRGKYSLVQHQRVHTGERPWECNECGKFFSQTSHLNDHRRIHTGERPYECSEC
GKSFIRKTHLIRHQTVHTNERPYECDECGKSYSQSSALLQHRRVHTGERPYKCGECGNSF
SQSAILNQHRRIHTGAKPYKCGQCGKSFSQKATLIKHQRVHTGERPYKCGDCGKSFSQSS
ILIQHRRIHTGARPYECGQCGKSFSQKSGLIQHQVVHTGERPYECNKCGNSFSQCSSLIH
HQKCHNTEAS
Download sequence
Identical sequences ENSGGOP00000024079 ENSGGOP00000013271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]