SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024082 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024082
Domain Number 1 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 535-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 479-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 323-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 17-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-19
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 6 Region: 268-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 386-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-16
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 8 Region: 215-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000047
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024082   Gene: ENSGGOG00000000018   Transcript: ENSGGOT00000025016
Sequence length 610
Comment pep:novel chromosome:gorGor3.1:19:50131016:50144498:-1 gene:ENSGGOG00000000018 transcript:ENSGGOT00000025016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHEEAAQKRKGKEPGMALPQGRLTFRDVAIEFSLAEWKFLNPAQRALYREVMLENYRNL
ESVDISSKRMMKEVLSTGQGNREVIHTGTLQRHESHHIGDFCFQEIKKEIHDIEFQCQED
ERNGLEAPMTKIKKLTGSTDQHDHRHAGNKPIKDQLGSSFYSHLPELHIFQIKGEIGNQL
EKSTIDAPSVSTSQRISCRPQTQISNNYGNNPPNSSLLPQKQEVHVREKSFQCNERGKAF
NFSSLLRKHQIIHLGDKQYKCDVCGKLFNHKQYLACHDRCHTGEKPYKCKECGKTFSQES
SLMHHRLHTGVKRYSCNECGKIFGQNSALLIDKAIHTGENPYKCNECDKAFNQQSQLSHH
RIHIGEKPYKCEECDKVFSRKSTLRHIRCNECGKTFCQNSDLLIHKSIHTGEQPYKCDEC
EKVFSRKSSLETHKISHTGEKPYKCKVCDKAFACHSYLAKHTRIHSGEKPYKCNECNKTF
SHRSYLVCHHRVHSGEKPYKCNECSKTFSRRSSLHCHRRLHSGEKPYKCNECGNTFRHCS
SLIYHRRLHTGEKSYKCTVCDKAFVRNSLLSRHTRIHTAEKPYKCNECGKAFNQQSHLSR
HHRIHTGEKP
Download sequence
Identical sequences ENSGGOP00000024082 ENSGGOP00000024082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]