SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024168 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024168
Domain Number 1 Region: 9-286
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.1e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024168   Gene: ENSGGOG00000022792   Transcript: ENSGGOT00000022730
Sequence length 382
Comment pep:novel chromosome:gorGor3.1:1:201136941:201138860:-1 gene:ENSGGOG00000022792 transcript:ENSGGOT00000022730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENISSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGSSGTFPLVDTCXKGDDINI
KQVLLNVRKFRMGLITADQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPAFDHSP
NKIMTEKYNRNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKATTAQKV
QQMKQRLNENERKRKRPRLTDT
Download sequence
Identical sequences ENSGGOP00000024168 ENSGGOP00000024168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]