SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024206 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024206
Domain Number 1 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.16e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 1-47
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 458-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 249-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 180-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000474
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 151-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000044
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024206   Gene: ENSGGOG00000024547   Transcript: ENSGGOT00000034638
Sequence length 515
Comment pep:known_by_projection chromosome:gorGor3.1:1:227634281:227649496:-1 gene:ENSGGOG00000024547 transcript:ENSGGOT00000034638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGLLAFRDVALEFSPEEWECLDPAQQSLYRDVMLENYRNLISLGEDNFNMQFLFHSLAMS
KPELIICLEARKEPWNMNTEKTAKHSASSSYLTEDILPEQGLQVSFQKVMLRRYERCCLE
KLRLRNDWEIVGEWKGQKASYNGLDLCSATTHSKNFQCNKCVKDFSKFANLNKRKISHAG
EKPFKCKECGNVSCMSLIMTQQQRIHIGENPYQCKKCGKAFNECSCFTDCKRIHVGEKHC
KCEEYNNIFKSCSSLAIVEKNHTEKKTYRCEECGKAFNLCSILTKHKKIHTGEKPYKCEE
CGKSFKLFPYLTQHKRIHSREKPYKCEECGKVFKLLSYLTQHRRIHTGKKTFQCEECGKA
FNQSSHLTEHRRIHTGEKPYKCEECGKAFTWFSYLIQHKRIHTGQKPYKCEECGKAFTWF
SYLTQHKRIHTGEKPYKCDECGKAFNWFSYLTNHKRIHTGEKPYKCEECGKAFGQSSHLS
KHKIIHTREKPYKCEECGKAFNHSAQLAVHEKTHT
Download sequence
Identical sequences ENSGGOP00000024206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]